SKU:59095757471
Cisco WS-X4712-SFP-E
Free Shipping on orders over $50
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 11 - Aug 16
Description
Cisco WS-X4712-SFP-EPart Number: WS X4712 SFP E Catalyst 4500 E Series 12 Port Ge (Sfp)
Part Number: CBS35024MGP4XUK | Cisco CBS350 Managed Switch
It is a reliable and cost-effective optical transceiver that provides fast data transfer speeds over long distances
A100 provides up to 20X higher performance over the prior NVIDIA Volta™ generation
Part Number: C9200CX-8P2X2GE | Catalyst 9000 Compact Switch
Part Number: UCS-CPU-6150 | 2
Part Number: SG250-18-K9-NA | Cisco Sg250-18 18-Port Gigabit Smart Switch Remanufactured
Z Domain Remanufactured
Part Number: SNS-3615-K9CHAS | Smallsecurentwrkserverchssisfriseapplictins Remanufactured
70Ghz)) Remanufactured
Reversedairflow Remanufactured
Part Number: NC55-SC | Ncs 5500 System Controller Remanufactured
Part Number: GMN-HGD-SO-4052 | Gm Node-Hgd Launch Amp
Quick Dispatch:
Your Cisco WS-X4712-SFP-E orders ship within 1-2 business days.
Delivery Options:
- Standard: 3-7 business days
- Fast: 2-3 business days
- Express: 1-2 business days
Order Tracking:
You'll receive a tracking link by email once your Cisco WS-X4712-SFP-E ships.
Need Help?
Questions about Cisco WS-X4712-SFP-E, sizing, or delivery? We're just an email away.
Live Shipping Estimates:
Enter your location at checkout to see available shipping methods and costs for Cisco WS-X4712-SFP-E in your area.
Get Shipping Estimates
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy